Domain: amberpublishers.in
Server Adress: 86.38.243.169

privdayz.com

/usr/share/locale/cy/LC_MESSAGES/
Dosya Yükle :
Current File : //usr/share/locale/cy/LC_MESSAGES/atk10.mo

����
�
�
�
�
 0I#i� ���C	W-a4���?S
:�
<�
74C,x$��B�
5-c'o#�"�(�=6E*|��	�������	
 
.	<
F
Q_lqx�����������
�	 %+?NV\in	s}�	����
��	�
�
����	-
7B
HS_	gqx
�	��
������
��
 (1N8���
����  &Ge���U�117c��A1>s?�<�8/1h&��Z�-3>r$���*�=4R,�
��������
4AP\m�����
�
����	
 (18ELTdjr
�����������-	3=NVbo{���������
�

 	%/CU	nx
	�������sc@wDLXl`V(Ef,P#dvSWQj5N
OTIx)1R$?
qFe/[3"izA\tuh6rMgn-	*o_9=.^<J]GC48 B+Y0;%{b'2pKZy:!}7ka&>Hm~|UAccessible DescriptionAccessible LayerAccessible MDI ValueAccessible NameAccessible ParentAccessible RoleAccessible Table CaptionAccessible Table Caption ObjectAccessible Table Column DescriptionAccessible Table Column HeaderAccessible Table Row DescriptionAccessible Table Row HeaderAccessible Table SummaryAccessible ValueDescription of an object, formatted for assistive technology accessEnd indexIs used to notify that the parent has changedIs used to notify that the table caption has changedIs used to notify that the table caption has changed; this property should not be used. accessible-table-caption-object should be used insteadIs used to notify that the table column description has changedIs used to notify that the table column header has changedIs used to notify that the table row description has changedIs used to notify that the table row header has changedIs used to notify that the table summary has changedIs used to notify that the value has changedNumber of Accessible Hypertext LinksNumber of AnchorsObject instance’s name formatted for assistive technology accessSelected LinkSpecifies whether the AtkHyperlink object is selectedStart indexThe accessible MDI value of this objectThe accessible layer of this objectThe accessible role of this objectThe end index of the AtkHyperlink objectThe number of anchors associated with the AtkHyperlink objectThe number of links which the current AtkHypertext hasThe start index of the AtkHyperlink objectaccelerator labelalertanimationapplicationarrowautocompletecalendarcanvascaptionchartcheck boxcheck menu itemcolor choosercolumn headercombo boxdateeditordesktop framedesktop icondialdialogdirectory panedocument framedrawing areaedit barembedded componententryfile chooserfillerfontchooserfooterformframeglass paneheaderheadinghtml containericonimageinput method windowinternal frameinvalidlabellayered panelinklistlist itemmenumenu barmenu itemoption panepagepage tabpage tab listpanelparagraphpassword textpopup menuprogress barpush buttonradio buttonradio menu itemredundant objectroot panerow headerrulerscroll barscroll panesectionseparatorsliderspin buttonsplit panestatusbartabletable celltable column headertable row headertear off menu itemterminaltexttoggle buttontool bartool tiptreetree tableunknownviewportwindowProject-Id-Version: atk
Report-Msgid-Bugs-To: 
POT-Creation-Date: 2009-12-21 15:05+0800
PO-Revision-Date: 2009-07-30 21:50+0100
Last-Translator: Iestyn Pryce <[email protected]>
Language-Team: Welsh <[email protected]>
Language: cy
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Disgrifiad HygyrcholHaen HygyrcholGwerth MDI HygyrcholEnw HygyrcholRhiant HygyrcholRôl HygyrcholCapsiwn Tabl HygyrcholGwrthrych Capsiwn Tabl HygyrcholDisgrifiad Colofn Tabl HygyrcholPennawd Colofn Tabl HygyrcholDisgrifiad Rhes Tabl HygyrcholPennawd Rhes Tabl HygyrcholCrynodeb Tabl HygyrcholGwerth HygyrcholDisgrifiad gwrthrych, wedi ei fformadu er mwyn ei ddefnyddio gyda technoleg hygyrcholRhif mynegai olafDefnyddir er mwyn hysbysu fod y rhiant wedi newidDefnyddir er mwyn hysbysu fod capsiwn y tabl wedi newidDefnyddir er mwyn hysbysu fod capsiwn y tabl wedi newid; ni ddylid defnyddio'r nodwedd hon. Dylid defnyddio accessible-table-caption-object yn ei lleDefnyddir er mwyn hysbysu fod disgrifiad colofn y tabl wedi newidDefnyddir er mwyn hysbysu fod pennawd colofn y tabl wedi newidDefnyddir er mwyn hysbysu fod disgrifiad rhes y tabl wedi newidDefnyddir er mwyn hysbysu fod pennawd rhes y tabl wedi newidDefnyddir er mwyn hysbysu fod crynodeb y tabl wedi newidDefnyddir er mwyn hysbysu fod y gwerth wedi newidNifer Cysylltion y Gordestun HygyrcholNifer yr AngorauEnw'r enghraifft gwrthrych wedi ei fformadu er mwyn ei ddefnyddio gyda technoleg hygyrcholDolen DdewisedigPenodi a yw'r gwrthrych AtkHyperlink wedi ei ddewisRhif mynegai cyntafGwerth MDI Hygyrchol y gwrthrych hwnHaen hygyrchol y gwrthrych hwnRôl hygyrchol y gwrthrych hwnRhif mynegai olaf y gwrthrych AtkHyperlinkNifer yr angorau sy'n gysylltiedig a'r gwrthrych AtkHyperlinkNifer y cysylltion sydd gan yr AtkHypertext cyfredolRhif mynegai cyntaf y gwrthrych AtkHyperlinklabel cyflymurhybuddanimeiddiadrhaglensaethcwblhad awtomatigcalendrcynfascapsiwnsiartblwch dewiseitem dewislen dewisdewiswr lliwpennawd colofnblwch cyfunnewidydd dyddiadffrâm bwrdd gwaitheicon bwrdd gwaithdeialdeialogchwarel cyfeiriadurffrâm ddogfenardal arluniobar golygucydran mewnosodiedcofnoddewiswr ffeiliaullenwydddewiswr ffonttroedynffurflenffrâmchwarel-wydrpenawdpennawdcynhwysydd htmleicondelweddffenest modd mewnbwnffrâm fewnolannilyslabelchwarel wedi haenucyswlltrhestreitem rhestrdewislenbar dewisleneitem dewislenchwarel opsiwntudalentab tudalenrhestr tab tudalenpanelparagrafftestun cyfrinairnaidlenbar cynnyddbotwm gwasgubotwm radioeitem dewislen radiogwrthrych diangenchwarel gwraiddpennawd rhesmesurbar sgroliochwarel sgrolioadrangwahanwrllithrwrbotwm troellichwarel holltbar-statwstablcell tablpennawd colofn tablpennawd rhes tableitem dewislen rhwygadwyterfynelltestunbotwm toglbar offercyngor offercoedentabl coedenanhysbysporth-golwgffenest

coded by Privdayz.com - Visit https://privdayz.com/ for more php shells.